Lineage for d1yymg_ (1yym G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1443695Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1443696Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1443697Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1443723Protein automated matches [190166] (2 species)
    not a true protein
  7. 1443724Species Human immunodeficiency virus 1 [TaxId:11676] [186893] (3 PDB entries)
  8. 1443725Domain d1yymg_: 1yym G: [124232]
    Other proteins in same PDB: d1yymh1, d1yymh2, d1yyml1, d1yyml2, d1yymm1, d1yymq1, d1yymq2, d1yymr1, d1yymr2, d1yyms1
    automated match to d1g9ng_
    complexed with edo, ipa, nag, ndg

Details for d1yymg_

PDB Entry: 1yym (more details), 2.2 Å

PDB Description: crystal structure of f23, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (G:) Exterior membrane glycoprotein(GP120)

SCOPe Domain Sequences for d1yymg_:

Sequence, based on SEQRES records: (download)

>d1yymg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqi
inmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrsel
ykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d1yymg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevg
kamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvki
e

SCOPe Domain Coordinates for d1yymg_:

Click to download the PDB-style file with coordinates for d1yymg_.
(The format of our PDB-style files is described here.)

Timeline for d1yymg_: