SCOPe 2.04: Domain d1yylq2: 1yyl Q:1108-1212

Lineage for d1yylq2 (1yyl Q:1108-1212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1yylq2: 1yyl Q:1108-1212 [124229]
   Other proteins in same PDB: d1yylg_, d1yylh1, d1yylh2, d1yyll1, d1yylm1, d1yylp_, d1yylq1, d1yylr1, d1yylr2, d1yyls1
   automatically matched to d1g9ml2
   complexed with nag, ndg

Details for d1yylq2

PDB Entry: 1yyl, 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b

PDB Compounds: (Q:) Antibody 17B Light chain

SCOPe Domain Sequences for d1yylq2:

Sequence; same for both SEQRES and ATOM records:

>d1yylq2 b.1.1.2 (Q:1108-1212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1yylq2:

• d1yylq2 first appeared in SCOP 1.73
  
• d1yylq2 appears in SCOPe 2.03
  
• d1yylq2 appears in SCOPe 2.05
  
• d1yylq2 appears in the current release, SCOPe 2.08