Lineage for d1yylp_ (1yyl P:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1227223Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1227224Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1227225Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1227251Protein automated matches [190166] (2 species)
    not a true protein
  7. 1227252Species Human immunodeficiency virus 1 [TaxId:11676] [186893] (3 PDB entries)
  8. 1227257Domain d1yylp_: 1yyl P: [124227]
    Other proteins in same PDB: d1yylh1, d1yylh2, d1yyll1, d1yyll2, d1yylm1, d1yylq1, d1yylq2, d1yylr1, d1yylr2, d1yyls1
    automated match to d1g9ng_
    complexed with nag, ndg

Details for d1yylp_

PDB Entry: 1yyl (more details), 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (P:) Exterior membrane glycoprotein(GP120)

SCOPe Domain Sequences for d1yylp_:

Sequence, based on SEQRES records: (download)

>d1yylp_ d.172.1.1 (P:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqi
inmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrsel
ykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d1yylp_ d.172.1.1 (P:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevg
kamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvki
e

SCOPe Domain Coordinates for d1yylp_:

Click to download the PDB-style file with coordinates for d1yylp_.
(The format of our PDB-style files is described here.)

Timeline for d1yylp_: