Lineage for d1yylp1 (1yyl P:1086-1492)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738566Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 738567Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 738568Family d.172.1.1: gp120 core [56503] (1 protein)
  6. 738569Protein gp120 core [56504] (1 species)
  7. 738570Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (10 PDB entries)
  8. 738580Domain d1yylp1: 1yyl P:1086-1492 [124227]
    Other proteins in same PDB: d1yylh1, d1yylh2, d1yyll1, d1yyll2, d1yylq1, d1yylq2, d1yylr1, d1yylr2
    automatically matched to d1g9ng_
    complexed with bif, mpt, nag, ndg, vlm; mutant

Details for d1yylp1

PDB Entry: 1yyl (more details), 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (P:) Exterior membrane glycoprotein(GP120)

SCOP Domain Sequences for d1yylp1:

Sequence, based on SEQRES records: (download)

>d1yylp1 d.172.1.1 (P:1086-1492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
lenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacpkvs
fepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeee
ivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm
wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky
kvvkie

Sequence, based on observed residues (ATOM records): (download)

>d1yylp1 d.172.1.1 (P:1086-1492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
lenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacpkvs
fepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeee
ivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevgkam
yappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie

SCOP Domain Coordinates for d1yylp1:

Click to download the PDB-style file with coordinates for d1yylp1.
(The format of our PDB-style files is described here.)

Timeline for d1yylp1: