Lineage for d1yylg_ (1yyl G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941821Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1941822Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1941823Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1941849Protein automated matches [190166] (2 species)
    not a true protein
  7. 1941850Species Human immunodeficiency virus 1 [TaxId:11676] [186893] (4 PDB entries)
  8. 1941854Domain d1yylg_: 1yyl G: [124222]
    Other proteins in same PDB: d1yylh1, d1yylh2, d1yyll1, d1yyll2, d1yylm1, d1yylq1, d1yylq2, d1yylr1, d1yylr2, d1yyls1
    automated match to d1g9ng_
    complexed with nag, ndg

Details for d1yylg_

PDB Entry: 1yyl (more details), 2.75 Å

PDB Description: crystal structure of cd4m33, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (G:) Exterior membrane glycoprotein(GP120)

SCOPe Domain Sequences for d1yylg_:

Sequence, based on SEQRES records: (download)

>d1yylg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqi
inmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrsel
ykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d1yylg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevg
kamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvki
e

SCOPe Domain Coordinates for d1yylg_:

Click to download the PDB-style file with coordinates for d1yylg_.
(The format of our PDB-style files is described here.)

Timeline for d1yylg_: