![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
![]() | Protein RNase III, C-terminal domain [54776] (3 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries) |
![]() | Domain d1yyka2: 1yyk A:151-221 [124219] Other proteins in same PDB: d1yyka1, d1yykb1 automated match to d2nugb2 protein/RNA complex; complexed with trs |
PDB Entry: 1yyk (more details), 2.5 Å
SCOPe Domain Sequences for d1yyka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yyka2 d.50.1.1 (A:151-221) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa eeliklleese
Timeline for d1yyka2: