Lineage for d1yyeb1 (1yye B:263-496)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647938Protein Estrogen receptor beta [48521] (2 species)
  7. 647939Species Human (Homo sapiens) [TaxId:9606] [48522] (15 PDB entries)
  8. 647942Domain d1yyeb1: 1yye B:263-496 [124214]
    automatically matched to d1l2jb_
    complexed with 196

Details for d1yyeb1

PDB Entry: 1yye (more details), 2.03 Å

PDB Description: Crystal structure of estrogen receptor beta complexed with way-202196
PDB Compounds: (B:) Estrogen receptor beta

SCOP Domain Sequences for d1yyeb1:

Sequence, based on SEQRES records: (download)

>d1yyeb1 a.123.1.1 (B:263-496) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
ttsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwvia
ksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemln

Sequence, based on observed residues (ATOM records): (download)

>d1yyeb1 a.123.1.1 (B:263-496) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
ttsrfrelklqhkeylcvkamillnssmdssrklahllnavtdalvwviaksgissqqqs
mrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemln

SCOP Domain Coordinates for d1yyeb1:

Click to download the PDB-style file with coordinates for d1yyeb1.
(The format of our PDB-style files is described here.)

Timeline for d1yyeb1: