Lineage for d1yyda_ (1yyd A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741620Protein automated matches [190089] (9 species)
    not a true protein
  7. 1741646Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186892] (6 PDB entries)
  8. 1741649Domain d1yyda_: 1yyd A: [124212]
    automated match to d1mn1__
    complexed with ca, gol, hem, man, mn, so4

Details for d1yyda_

PDB Entry: 1yyd (more details), 1.45 Å

PDB Description: high resolution crystal structure of manganese peroxidase
PDB Compounds: (A:) Peroxidase manganese-dependent I

SCOPe Domain Sequences for d1yyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyda_ a.93.1.1 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa

SCOPe Domain Coordinates for d1yyda_:

Click to download the PDB-style file with coordinates for d1yyda_.
(The format of our PDB-style files is described here.)

Timeline for d1yyda_: