Lineage for d1yy9a3 (1yy9 A:163-311)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961098Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 1961099Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1961100Protein EGF receptor Cys-rich domains [82887] (1 species)
  7. 1961101Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries)
  8. 1961103Domain d1yy9a3: 1yy9 A:163-311 [124209]
    Other proteins in same PDB: d1yy9a1, d1yy9a2, d1yy9c1, d1yy9c2
    automatically matched to d1ivoa3
    complexed with nag, ndg

Details for d1yy9a3

PDB Entry: 1yy9 (more details), 2.6 Å

PDB Description: structure of the extracellular domain of the epidermal growth factor receptor in complex with the fab fragment of cetuximab/erbitux/imc- c225
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1yy9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yy9a3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

SCOPe Domain Coordinates for d1yy9a3:

Click to download the PDB-style file with coordinates for d1yy9a3.
(The format of our PDB-style files is described here.)

Timeline for d1yy9a3: