Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
Domain d1yy9a3: 1yy9 A:163-311 [124209] Other proteins in same PDB: d1yy9a1, d1yy9a2, d1yy9a4, d1yy9a5, d1yy9c1, d1yy9c2, d1yy9d_ automatically matched to d1ivoa3 complexed with nag |
PDB Entry: 1yy9 (more details), 2.61 Å
SCOPe Domain Sequences for d1yy9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yy9a3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs cvracgadsyemeedgvrkckkcegpcrk
Timeline for d1yy9a3:
View in 3D Domains from same chain: (mouse over for more information) d1yy9a1, d1yy9a2, d1yy9a4, d1yy9a5 |