Lineage for d1yy9a3 (1yy9 A:163-311)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3030969Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
  6. Protein EGF receptor Cys-rich domains, N-terminal domain [419056] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419547] (4 PDB entries)
  8. 3030982Domain d1yy9a3: 1yy9 A:163-311 [124209]
    Other proteins in same PDB: d1yy9a1, d1yy9a2, d1yy9a4, d1yy9a5, d1yy9c1, d1yy9c2, d1yy9d_
    automatically matched to d1ivoa3
    complexed with nag

Details for d1yy9a3

PDB Entry: 1yy9 (more details), 2.61 Å

PDB Description: structure of the extracellular domain of the epidermal growth factor receptor in complex with the fab fragment of cetuximab/erbitux/imc- c225
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1yy9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yy9a3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

SCOPe Domain Coordinates for d1yy9a3:

Click to download the PDB-style file with coordinates for d1yy9a3.
(The format of our PDB-style files is described here.)

Timeline for d1yy9a3: