![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
![]() | Protein EGF receptor extracellular domain [82326] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries) |
![]() | Domain d1yy9a1: 1yy9 A:6-162 [124207] Other proteins in same PDB: d1yy9a3, d1yy9a4, d1yy9a5, d1yy9c1, d1yy9c2, d1yy9d_ automatically matched to d1moxa1 complexed with nag |
PDB Entry: 1yy9 (more details), 2.61 Å
SCOPe Domain Sequences for d1yy9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yy9a1 c.10.2.5 (A:6-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} vcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyv lialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilhgavr fsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgs
Timeline for d1yy9a1:
![]() Domains from same chain: (mouse over for more information) d1yy9a2, d1yy9a3, d1yy9a4, d1yy9a5 |