SCOP 1.73: Domain d1yxyb1: 1yxy B:4-233

Lineage for d1yxyb1 (1yxy B:4-233)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.5: NanE-like [117362] (1 protein)
   Pfam PF04131

6. Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (2 species)

7. Species Streptococcus pyogenes [TaxId:1314] [141754] (1 PDB entry)

8. Domain d1yxyb1: 1yxy B:4-233 [124204]
   automatically matched to 1YXY A:4-233

Details for d1yxyb1

PDB Entry: 1yxy, 1.6 Å

PDB Description: Crystal Structure of putative N-acetylmannosamine-6-P epimerase from Streptococcus pyogenes (APC29713) Structural genomics, MCSG

PDB Compounds: (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOP Domain Sequences for d1yxyb1:

Sequence; same for both SEQRES and ATOM records:

>d1yxyb1 c.1.2.5 (B:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]}
kptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrdike
iqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldiasf
irqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvaliealc
kagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealk

Timeline for d1yxyb1:

• d1yxyb1 is new in SCOP 1.73
  
• d1yxyb1 appears in SCOP 1.75
  
• d1yxyb1 appears in the current release, SCOPe 2.08, called d1yxyb_