![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.5: NanE-like [117362] (1 protein) Pfam PF04131 |
![]() | Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (3 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [141754] (1 PDB entry) Uniprot P65522 4-233 |
![]() | Domain d1yxya1: 1yxy A:4-233 [124203] |
PDB Entry: 1yxy (more details), 1.6 Å
SCOPe Domain Sequences for d1yxya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} kptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrdike iqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldiasf irqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvaliealc kagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealk
Timeline for d1yxya1: