Lineage for d1yxya1 (1yxy A:4-233)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827411Family c.1.2.5: NanE-like [117362] (1 protein)
    Pfam PF04131
  6. 2827412Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (3 species)
  7. 2827416Species Streptococcus pyogenes [TaxId:1314] [141754] (1 PDB entry)
    Uniprot P65522 4-233
  8. 2827417Domain d1yxya1: 1yxy A:4-233 [124203]

Details for d1yxya1

PDB Entry: 1yxy (more details), 1.6 Å

PDB Description: Crystal Structure of putative N-acetylmannosamine-6-P epimerase from Streptococcus pyogenes (APC29713) Structural genomics, MCSG
PDB Compounds: (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d1yxya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]}
kptkeklmeqlkggiivscqalpgeplysetggimplmakaaqeagavgiransvrdike
iqaitdlpiigiikkdyppqepfitatmtevdqlaalniaviamdctkrdrhdgldiasf
irqvkekypnqllmadistfdeglvahqagidfvgttlsgytpysrqeagpdvaliealc
kagiaviaegkihspeeakkindlgvagivvggaitrpkeiaerfiealk

SCOPe Domain Coordinates for d1yxya1:

Click to download the PDB-style file with coordinates for d1yxya1.
(The format of our PDB-style files is described here.)

Timeline for d1yxya1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yxyb_