SCOPe 2.07: Domain d1yxwa2: 1yxw A:1111-1315

Lineage for d1yxwa2 (1yxw A:1111-1315)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein Tetanus neurotoxin [50400] (1 species)

7. Species Clostridium tetani [TaxId:1513] [50401] (10 PDB entries)

8. Domain d1yxwa2: 1yxw A:1111-1315 [124202]
   Other proteins in same PDB: d1yxwa1
   automated match to d1dlla2
   complexed with tyr

Details for d1yxwa2

PDB Entry: 1yxw, 2.2 Å

PDB Description: A common binding site for disialyllactose and a tri-peptide in the C-fragment of tetanus neurotoxin

PDB Compounds: (A:) Tetanus toxin (Tentoxylysin)

SCOPe Domain Sequences for d1yxwa2:

Sequence; same for both SEQRES and ATOM records:

>d1yxwa2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

Timeline for d1yxwa2:

• d1yxwa2 first appeared in SCOP 1.73
  
• d1yxwa2 appears in SCOPe 2.06
  
• d1yxwa2 appears in the current release, SCOPe 2.08