Lineage for d1yxra1 (1yxr A:1-77)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764213Superfamily a.7.14: MIT domain [116846] (1 family) (S)
  5. 764214Family a.7.14.1: MIT domain [116847] (3 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 764218Protein Vacuolar protein sorting factor 4a (VPS4A, SKD2) [140352] (1 species)
  7. 764219Species Human (Homo sapiens) [TaxId:9606] [140353] (2 PDB entries)
    Uniprot Q9UN37 1-77
  8. 764221Domain d1yxra1: 1yxr A:1-77 [124200]

Details for d1yxra1

PDB Entry: 1yxr (more details)

PDB Description: NMR Structure of VPS4A MIT Domain
PDB Compounds: (A:) vacuolar protein sorting factor 4A

SCOP Domain Sequences for d1yxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxra1 a.7.14.1 (A:1-77) Vacuolar protein sorting factor 4a (VPS4A, SKD2) {Human (Homo sapiens) [TaxId: 9606]}
mttstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakc
vqyldraeklkdylrsk

SCOP Domain Coordinates for d1yxra1:

Click to download the PDB-style file with coordinates for d1yxra1.
(The format of our PDB-style files is described here.)

Timeline for d1yxra1: