Lineage for d1yxqa2 (1yxq A:147-371)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701286Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 701287Protein Actin [53073] (6 species)
  7. 701298Species Cow (Bos taurus) [TaxId:9913] [53074] (25 PDB entries)
  8. 701332Domain d1yxqa2: 1yxq A:147-371 [124197]
    automatically matched to d1hlua2
    complexed with atp, edo, mg, swi

Details for d1yxqa2

PDB Entry: 1yxq (more details), 2.01 Å

PDB Description: crystal structure of actin in complex with swinholide a
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOP Domain Sequences for d1yxqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxqa2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

SCOP Domain Coordinates for d1yxqa2:

Click to download the PDB-style file with coordinates for d1yxqa2.
(The format of our PDB-style files is described here.)

Timeline for d1yxqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yxqa1