Lineage for d1yxla1 (1yxl A:1-120)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649293Species Indian cobra (Naja naja sagittifera), isoform 4 [TaxId:195058] [89171] (7 PDB entries)
  8. 649294Domain d1yxla1: 1yxl A:1-120 [124191]
    automatically matched to d1oxra_
    complexed with acy, ca, po4

Details for d1yxla1

PDB Entry: 1yxl (more details), 1.48 Å

PDB Description: crystal structure of a novel phospholipase a2 from naja naja sagittifera at 1.5 a resolution
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOP Domain Sequences for d1yxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxla1 a.133.1.2 (A:1-120) Snake phospholipase A2 {Indian cobra (Naja naja sagittifera), isoform 4 [TaxId: 195058]}
nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOP Domain Coordinates for d1yxla1:

Click to download the PDB-style file with coordinates for d1yxla1.
(The format of our PDB-style files is described here.)

Timeline for d1yxla1: