Lineage for d1yxkb_ (1yxk B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608476Domain d1yxkb_: 1yxk B: [124190]
    automated match to d1hyra_

Details for d1yxkb_

PDB Entry: 1yxk (more details), 2.4 Å

PDB Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) disulfide-linked dimer
PDB Compounds: (B:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1yxkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxkb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvancsapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqai
syssfpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaen
cilaafsicqkkanl

SCOPe Domain Coordinates for d1yxkb_:

Click to download the PDB-style file with coordinates for d1yxkb_.
(The format of our PDB-style files is described here.)

Timeline for d1yxkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yxka_