SCOP 1.73: Domain d1yxkb1: 1yxk B:140-270

Lineage for d1yxkb1 (1yxk B:140-270)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Oxidised low density lipoprotein [143955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143956] (5 PDB entries)

8. Domain d1yxkb1: 1yxk B:140-270 [124190]
   automatically matched to 1YPQ A:140-270

Details for d1yxkb1

PDB Entry: 1yxk, 2.4 Å

PDB Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) disulfide-linked dimer

PDB Compounds: (B:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOP Domain Sequences for d1yxkb1:

Sequence; same for both SEQRES and ATOM records:

>d1yxkb1 d.169.1.1 (B:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]}
csapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyss
fpfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencila
afsicqkkanl

Timeline for d1yxkb1:

• d1yxkb1 is new in SCOP 1.73
  
• d1yxkb1 appears in SCOP 1.75
  
• d1yxkb1 appears in the current release, SCOPe 2.08, called d1yxkb_