SCOP 1.75: Domain d1yxka1: 1yxk A:141-270

Lineage for d1yxka1 (1yxk A:141-270)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Oxidised low density lipoprotein [143955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143956] (5 PDB entries)
   Uniprot P78380 140-270

8. Domain d1yxka1: 1yxk A:141-270 [124189]
   automatically matched to 1YPQ A:140-270

Details for d1yxka1

PDB Entry: 1yxk, 2.4 Å

PDB Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) disulfide-linked dimer

PDB Compounds: (A:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOP Domain Sequences for d1yxka1:

Sequence; same for both SEQRES and ATOM records:

>d1yxka1 d.169.1.1 (A:141-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]}
sapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
fsicqkkanl

Timeline for d1yxka1:

• d1yxka1 first appeared in SCOP 1.73
  
• d1yxka1 is called d1yxka_ in SCOPe 2.01
  
• d1yxka1 appears in the current release, SCOPe 2.08, called d1yxka_