Lineage for d1yxjb_ (1yxj B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048685Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1048686Protein automated matches [190159] (5 species)
    not a true protein
  7. 1048699Species Human (Homo sapiens) [TaxId:9606] [186882] (14 PDB entries)
  8. 1048727Domain d1yxjb_: 1yxj B: [124188]
    automated match to d1hyra_
    complexed with edo

Details for d1yxjb_

PDB Entry: 1yxj (more details), 1.78 Å

PDB Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) at low pH
PDB Compounds: (B:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1yxjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxjb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf
wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs
icqkkanl

SCOPe Domain Coordinates for d1yxjb_:

Click to download the PDB-style file with coordinates for d1yxjb_.
(The format of our PDB-style files is described here.)

Timeline for d1yxjb_: