SCOPe 2.08: Domain d1yxja2: 1yxj A:143-271

Lineage for d1yxja2 (1yxj A:143-271)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d1yxja2: 1yxj A:143-271 [124187]
   Other proteins in same PDB: d1yxja3
   automated match to d1hyra_
   complexed with edo

Details for d1yxja2

PDB Entry: 1yxj, 1.78 Å

PDB Description: Crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (LOX-1) at low pH

PDB Compounds: (A:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1yxja2:

Sequence; same for both SEQRES and ATOM records:

>d1yxja2 d.169.1.0 (A:143-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf
wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs
icqkkanlr

Timeline for d1yxja2:

• d1yxja2 first appeared in SCOP 1.73, called d1yxja1
  
• d1yxja2 was called d1yxja_ in SCOPe 2.07