Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Dihydrodipicolinate synthase [51574] (13 species) |
Species Escherichia coli [TaxId:562] [51575] (16 PDB entries) |
Domain d1yxdb_: 1yxd B: [124186] automated match to d1dhpa_ complexed with cl, k, lys |
PDB Entry: 1yxd (more details), 2 Å
SCOPe Domain Sequences for d1yxdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yxdb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
Timeline for d1yxdb_: