Lineage for d1yxdb_ (1yxd B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097054Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2097093Species Escherichia coli [TaxId:562] [51575] (16 PDB entries)
  8. 2097103Domain d1yxdb_: 1yxd B: [124186]
    automated match to d1dhpa_
    complexed with cl, k, lys

Details for d1yxdb_

PDB Entry: 1yxd (more details), 2 Å

PDB Description: structure of e. coli dihydrodipicolinate synthase bound with allosteric inhibitor (s)-lysine to 2.0 a
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1yxdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yxdb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d1yxdb_:

Click to download the PDB-style file with coordinates for d1yxdb_.
(The format of our PDB-style files is described here.)

Timeline for d1yxdb_: