SCOP 1.75: Domain d1yxca1: 1yxc A:1-292

Lineage for d1yxca1 (1yxc A:1-292)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (4 species)

7. Species Escherichia coli [TaxId:562] [51575] (9 PDB entries)

8. Domain d1yxca1: 1yxc A:1-292 [124183]
   automatically matched to d1dhpa_
   complexed with cl, k

Details for d1yxca1

PDB Entry: 1yxc, 1.9 Å

PDB Description: structure of e. coli dihydrodipicolinate synthase to 1.9 a

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOP Domain Sequences for d1yxca1:

Sequence; same for both SEQRES and ATOM records:

>d1yxca1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

Timeline for d1yxca1:

• d1yxca1 first appeared in SCOP 1.73
  
• d1yxca1 is called d1yxca_ in SCOPe 2.01
  
• d1yxca1 appears in the current release, SCOPe 2.08, called d1yxca_