Lineage for d1yx9a1 (1yx9 A:1-327)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672651Protein Pepsin(ogen) [50658] (4 species)
  7. 672663Species Pig (Sus scrofa) [TaxId:9823] [50659] (8 PDB entries)
  8. 672672Domain d1yx9a1: 1yx9 A:1-327 [124174]
    automatically matched to d1f34a_
    complexed with dms

Details for d1yx9a1

PDB Entry: 1yx9 (more details), 3 Å

PDB Description: Effect of Dimethyl Sulphoxide on the crystal structure of Porcine Pepsin
PDB Compounds: (A:) pepsinogen A

SCOP Domain Sequences for d1yx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx9a1 b.50.1.2 (A:1-327) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

SCOP Domain Coordinates for d1yx9a1:

Click to download the PDB-style file with coordinates for d1yx9a1.
(The format of our PDB-style files is described here.)

Timeline for d1yx9a1: