![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Pepsin(ogen) [50658] (4 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50659] (12 PDB entries) |
![]() | Domain d1yx9a_: 1yx9 A: [124174] automated match to d5pepa_ complexed with dms |
PDB Entry: 1yx9 (more details), 3 Å
SCOPe Domain Sequences for d1yx9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yx9a_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi lgdvfirqyytvfdrannkvglapva
Timeline for d1yx9a_: