Lineage for d1yx9a_ (1yx9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2802095Protein Pepsin(ogen) [50658] (4 species)
  7. 2802108Species Pig (Sus scrofa) [TaxId:9823] [50659] (12 PDB entries)
  8. 2802116Domain d1yx9a_: 1yx9 A: [124174]
    automated match to d5pepa_
    complexed with dms

Details for d1yx9a_

PDB Entry: 1yx9 (more details), 3 Å

PDB Description: Effect of Dimethyl Sulphoxide on the crystal structure of Porcine Pepsin
PDB Compounds: (A:) pepsinogen A

SCOPe Domain Sequences for d1yx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx9a_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

SCOPe Domain Coordinates for d1yx9a_:

Click to download the PDB-style file with coordinates for d1yx9a_.
(The format of our PDB-style files is described here.)

Timeline for d1yx9a_: