![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (7 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (47 PDB entries) identical sequence in many other species |
![]() | Domain d1yx5b1: 1yx5 B:1-76 [124172] automatically matched to d1aara_ |
PDB Entry: 1yx5 (more details)
SCOP Domain Sequences for d1yx5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yx5b1 d.15.1.1 (B:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d1yx5b1: