Lineage for d1yx1c_ (1yx1 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839412Family c.1.15.7: KguE-like [141854] (1 protein)
    part of Pfam PF01261
  6. 2839413Protein Hypothetical protein PA2260 [141855] (1 species)
    2-ketogluconate utilization operon protein KguE
  7. 2839414Species Pseudomonas aeruginosa [TaxId:287] [141856] (1 PDB entry)
    Uniprot Q9I1L3 3-252
  8. 2839417Domain d1yx1c_: 1yx1 C: [124171]
    automated match to d1yx1a1
    complexed with ipa, na

Details for d1yx1c_

PDB Entry: 1yx1 (more details), 1.8 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA2260 from Pseudomonas aeruginosa, Possible Sugar Phosphate Isomerase
PDB Compounds: (C:) hypothetical protein PA2260

SCOPe Domain Sequences for d1yx1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx1c_ c.1.15.7 (C:) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]}
lhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqg
lecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarh
glqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgry
vgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddllslsrr
hiaalarlgq

SCOPe Domain Coordinates for d1yx1c_:

Click to download the PDB-style file with coordinates for d1yx1c_.
(The format of our PDB-style files is described here.)

Timeline for d1yx1c_: