SCOPe 2.06: Domain d1yx1b_: 1yx1 B:

Lineage for d1yx1b_ (1yx1 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.7: KguE-like [141854] (1 protein)
   part of Pfam PF01261

6. Protein Hypothetical protein PA2260 [141855] (1 species)
   2-ketogluconate utilization operon protein KguE

7. Species Pseudomonas aeruginosa [TaxId:287] [141856] (1 PDB entry)
   Uniprot Q9I1L3 3-252

8. Domain d1yx1b_: 1yx1 B: [124170]
   automated match to d1yx1a1
   complexed with ipa, na

Details for d1yx1b_

PDB Entry: 1yx1, 1.8 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA2260 from Pseudomonas aeruginosa, Possible Sugar Phosphate Isomerase

PDB Compounds: (B:) hypothetical protein PA2260

SCOPe Domain Sequences for d1yx1b_:

Sequence; same for both SEQRES and ATOM records:

>d1yx1b_ c.1.15.7 (B:) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]}
lhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqg
lecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarh
glqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgry
vgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddllslsrr
hiaalarlgqp

Timeline for d1yx1b_:

• d1yx1b_ first appeared in SCOP 1.73, called d1yx1b1
  
• d1yx1b_ appears in SCOPe 2.05
  
• d1yx1b_ appears in SCOPe 2.07
  
• d1yx1b_ appears in the current release, SCOPe 2.08