SCOP 1.73: Domain d1yx1a1: 1yx1 A:3-252

Lineage for d1yx1a1 (1yx1 A:3-252)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (7 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.7: KguE-like [141854] (1 protein)
   part of Pfam PF01261

6. Protein Hypothetical protein PA2260 [141855] (1 species)
   2-ketogluconate utilization operon protein KguE

7. Species Pseudomonas aeruginosa [TaxId:287] [141856] (1 PDB entry)

8. Domain d1yx1a1: 1yx1 A:3-252 [124169]
   complexed with ipa, na

Details for d1yx1a1

PDB Entry: 1yx1, 1.8 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA2260 from Pseudomonas aeruginosa, Possible Sugar Phosphate Isomerase

PDB Compounds: (A:) hypothetical protein PA2260

SCOP Domain Sequences for d1yx1a1:

Sequence; same for both SEQRES and ATOM records:

>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]}
lhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqg
lecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarh
glqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgry
vgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddllslsrr
hiaalarlgq

Timeline for d1yx1a1:

• d1yx1a1 is new in SCOP 1.73
  
• d1yx1a1 appears in SCOP 1.75
  
• d1yx1a1 appears in the current release, SCOPe 2.08