SCOPe 2.06: Domain d1ywya1: 1ywy A:23-96

Lineage for d1ywya1 (1ywy A:23-96)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.2: PA2021-like [141447] (1 family)
   prokaryotiic proteins of PH domain-like fold lacking the N-terminal strand
   automatically mapped to Pfam PF11462

5. Family b.55.2.1: PA2021-like [141448] (1 protein)
   small family specific to Pseudomonas

6. Protein Hypothetical protein PA2021 [141449] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141450] (1 PDB entry)
   Uniprot Q9I293 1-74

8. Domain d1ywya1: 1ywy A:23-96 [124166]

Details for d1ywya1

PDB Entry: 1ywy

PDB Description: Solution Structure of Pseudomonas aeruginosa Protein PA2021. The Northeast Structural Genomics Consortium Target Pat85.

PDB Compounds: (A:) hypothetical protein PA2021

SCOPe Domain Sequences for d1ywya1:

Sequence; same for both SEQRES and ATOM records:

>d1ywya1 b.55.2.1 (A:23-96) Hypothetical protein PA2021 {Pseudomonas aeruginosa [TaxId: 287]}
msieidseqgvcsveiegsrhrapvdslrigtdaearlsvlyidgkrlhiseedaqrlvv
agaedqrrhlmadd

Timeline for d1ywya1:

• d1ywya1 first appeared in SCOP 1.73
  
• d1ywya1 appears in SCOPe 2.05
  
• d1ywya1 appears in SCOPe 2.07
  
• d1ywya1 appears in the current release, SCOPe 2.08