SCOPe 2.06: Domain d1ywxa1: 1ywx A:1-102

Lineage for d1ywxa1 (1ywx A:1-102)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein)
   Pfam PF01282

6. Protein Ribosomal protein S24e [117787] (4 species)

7. Species Methanococcus maripaludis [TaxId:39152] [142895] (1 PDB entry)
   Uniprot P61193 1-102

8. Domain d1ywxa1: 1ywx A:1-102 [124165]

Details for d1ywxa1

PDB Entry: 1ywx

PDB Description: solution structure of methanococcus maripaludis protein mmp0443: the northeast structural genomics consortium target mrr16

PDB Compounds: (A:) 30S ribosomal protein S24e

SCOPe Domain Sequences for d1ywxa1:

Sequence; same for both SEQRES and ATOM records:

>d1ywxa1 d.12.1.3 (A:1-102) Ribosomal protein S24e {Methanococcus maripaludis [TaxId: 39152]}
mdisiisdrnnpllqrreikftvsfdaatpsikdvkmklvavlnankqvlvvdtldqifg
kleaegyakiyndekamatietksvleknkieeeaeaevaee

Timeline for d1ywxa1:

• d1ywxa1 first appeared in SCOP 1.73
  
• d1ywxa1 appears in SCOPe 2.05
  
• d1ywxa1 appears in SCOPe 2.07
  
• d1ywxa1 appears in the current release, SCOPe 2.08