Lineage for d1ywxa1 (1ywx A:1-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929542Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2929543Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2929700Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein)
    Pfam PF01282
  6. 2929701Protein Ribosomal protein S24e [117787] (4 species)
  7. 2929702Species Methanococcus maripaludis [TaxId:39152] [142895] (1 PDB entry)
    Uniprot P61193 1-102
  8. 2929703Domain d1ywxa1: 1ywx A:1-102 [124165]

Details for d1ywxa1

PDB Entry: 1ywx (more details)

PDB Description: solution structure of methanococcus maripaludis protein mmp0443: the northeast structural genomics consortium target mrr16
PDB Compounds: (A:) 30S ribosomal protein S24e

SCOPe Domain Sequences for d1ywxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywxa1 d.12.1.3 (A:1-102) Ribosomal protein S24e {Methanococcus maripaludis [TaxId: 39152]}
mdisiisdrnnpllqrreikftvsfdaatpsikdvkmklvavlnankqvlvvdtldqifg
kleaegyakiyndekamatietksvleknkieeeaeaevaee

SCOPe Domain Coordinates for d1ywxa1:

Click to download the PDB-style file with coordinates for d1ywxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ywxa1: