Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
Protein Hypothetical oxidoreductase BC1844 [143612] (1 species) |
Species Bacillus cereus [TaxId:1396] [143613] (1 PDB entry) Uniprot Q81EW9 2-200 |
Domain d1ywqa1: 1ywq A:2-200 [124162] complexed with fmn |
PDB Entry: 1ywq (more details), 2.3 Å
SCOPe Domain Sequences for d1ywqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywqa1 d.90.1.1 (A:2-200) Hypothetical oxidoreductase BC1844 {Bacillus cereus [TaxId: 1396]} satttnlkeaivnrrsirkvtkndaitkerieevlktalhaptsfnmqsgrmvvlmdgeh ekfwdivketlrarvpaenfeatverlkgfhagvgtvlffedqatvekmqenaplykdqf pfwshqgnamlqhtvwmllsaegigaslqhynpivdaevketwnipaewslvgqmpfgep neqpaertflptedvvkfy
Timeline for d1ywqa1: