Lineage for d1ywqa1 (1ywq A:2-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963291Protein Hypothetical oxidoreductase BC1844 [143612] (1 species)
  7. 2963292Species Bacillus cereus [TaxId:1396] [143613] (1 PDB entry)
    Uniprot Q81EW9 2-200
  8. 2963293Domain d1ywqa1: 1ywq A:2-200 [124162]
    complexed with fmn

Details for d1ywqa1

PDB Entry: 1ywq (more details), 2.3 Å

PDB Description: Crystal structure of a nitroreductase family protein from Bacillus cereus ATCC 14579
PDB Compounds: (A:) Nitroreductase family protein

SCOPe Domain Sequences for d1ywqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywqa1 d.90.1.1 (A:2-200) Hypothetical oxidoreductase BC1844 {Bacillus cereus [TaxId: 1396]}
satttnlkeaivnrrsirkvtkndaitkerieevlktalhaptsfnmqsgrmvvlmdgeh
ekfwdivketlrarvpaenfeatverlkgfhagvgtvlffedqatvekmqenaplykdqf
pfwshqgnamlqhtvwmllsaegigaslqhynpivdaevketwnipaewslvgqmpfgep
neqpaertflptedvvkfy

SCOPe Domain Coordinates for d1ywqa1:

Click to download the PDB-style file with coordinates for d1ywqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ywqa1: