Lineage for d1ywna_ (1ywn A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [56161] (30 PDB entries)
  8. Domain d1ywna_: 1ywn A: [124161]
    automated match to d1vr2a_
    complexed with lif

Details for d1ywna_

PDB Entry: 1ywn (more details), 1.7100000000000002 Å

PDB Description: vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
PDB Compounds: (A:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d1ywna_:

Sequence, based on SEQRES records: (download)

>d1ywna_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqanaq
qd

Sequence, based on observed residues (ATOM records): (download)

>d1ywna_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlthsehralm
selkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpfltleh
licysfqvakgmeflasrkcihrdlaarnillseknvvkicdiykdpdyvrkgdarlplk
wmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdy
ttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqd

SCOPe Domain Coordinates for d1ywna_ are not available.

Timeline for d1ywna_: