![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.13: KduI-like [110318] (1 protein) Pfam PF04962: duplication: consists of two germin-like domains |
![]() | Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [141602] (1 PDB entry) Uniprot Q838L9 1-260 |
![]() | Domain d1ywkf2: 1ywk F:1001-1260 [124160] Other proteins in same PDB: d1ywka2, d1ywkb3, d1ywkc3, d1ywkd3, d1ywke3, d1ywkf3 automated match to d1ywka1 |
PDB Entry: 1ywk (more details), 2.95 Å
SCOPe Domain Sequences for d1ywkf2:
Sequence, based on SEQRES records: (download)
>d1ywkf2 b.82.1.13 (F:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} metrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteeleii ldkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenpdn pakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmgyt ilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispsw sihsgvgtsnysfiwamcge
>d1ywkf2 b.82.1.13 (F:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} metrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteeleii ldkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenpdn pakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmgyt ilepgsawntmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgvgts nysfiwamcge
Timeline for d1ywkf2: