Lineage for d1ywka1 (1ywk A:1001-1260)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070417Family b.82.1.13: KduI-like [110318] (1 protein)
    Pfam PF04962: duplication: consists of two germin-like domains
  6. 2070418Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)
  7. 2070419Species Enterococcus faecalis [TaxId:1351] [141602] (1 PDB entry)
    Uniprot Q838L9 1-260
  8. 2070420Domain d1ywka1: 1ywk A:1001-1260 [124155]
    Other proteins in same PDB: d1ywka2, d1ywkb3, d1ywkc3, d1ywkd3, d1ywke3, d1ywkf3

Details for d1ywka1

PDB Entry: 1ywk (more details), 2.95 Å

PDB Description: Crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from Enterococcus faecalis
PDB Compounds: (A:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase 1

SCOPe Domain Sequences for d1ywka1:

Sequence, based on SEQRES records: (download)

>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]}
metrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteeleii
ldkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenpdn
pakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmgyt
ilepgsawntmpchtherrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispsw
sihsgvgtsnysfiwamcge

Sequence, based on observed residues (ATOM records): (download)

>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]}
metrythspadirhysteqlrdeflvekvfipgaisltythndrmifggvtptteeleii
ldkelgvdyflerrelgviniggpgfieidgaketmkkqdgyyigketkhvrfssenpdn
pakfyiscvpahhkypnvkisideitpmetgdpltlnqrkiyqyihpnvcescqlqmgyt
ilepgsawntrmeayvyfdmeedtrifhmmgkpdetkhlvmsneqaaispswsihsgvgt
snysfiwamcge

SCOPe Domain Coordinates for d1ywka1:

Click to download the PDB-style file with coordinates for d1ywka1.
(The format of our PDB-style files is described here.)

Timeline for d1ywka1: