Lineage for d1ywgq2 (1ywg Q:153-318)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961800Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (4 PDB entries)
    Uniprot Q8IKK7 153-318! Uniprot Q8T6B1 153-318
  8. 2961815Domain d1ywgq2: 1ywg Q:153-318 [124150]
    Other proteins in same PDB: d1ywgo1, d1ywgp1, d1ywgq1, d1ywgr1
    automated match to d1ywgo2
    complexed with nad

Details for d1ywgq2

PDB Entry: 1ywg (more details), 2.6 Å

PDB Description: The structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1ywgq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywgq2 d.81.1.1 (Q:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa
stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp
lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd

SCOPe Domain Coordinates for d1ywgq2:

Click to download the PDB-style file with coordinates for d1ywgq2.
(The format of our PDB-style files is described here.)

Timeline for d1ywgq2: