Lineage for d1ywgq1 (1ywg Q:1-152,Q:319-337)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578524Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1578612Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (3 PDB entries)
    Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337
  8. 1578623Domain d1ywgq1: 1ywg Q:1-152,Q:319-337 [124149]
    Other proteins in same PDB: d1ywgo2, d1ywgp2, d1ywgq2, d1ywgr2
    automated match to d1ywgo1
    complexed with nad

Details for d1ywgq1

PDB Entry: 1ywg (more details), 2.6 Å

PDB Description: The structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1ywgq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywgq1 c.2.1.3 (Q:1-152,Q:319-337) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcev
thadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvi
msappkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhitnn

SCOPe Domain Coordinates for d1ywgq1:

Click to download the PDB-style file with coordinates for d1ywgq1.
(The format of our PDB-style files is described here.)

Timeline for d1ywgq1: