SCOPe 2.08: Domain d1ywgq1: 1ywg Q:1-152,Q:319-337

Lineage for d1ywgq1 (1ywg Q:1-152,Q:319-337)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (4 PDB entries)
   Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337

8. Domain d1ywgq1: 1ywg Q:1-152,Q:319-337 [124149]
   Other proteins in same PDB: d1ywgo2, d1ywgp2, d1ywgq2, d1ywgr2
   automated match to d1ywgo1
   complexed with nad

Details for d1ywgq1

PDB Entry: 1ywg, 2.6 Å

PDB Description: The structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum

PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1ywgq1:

Sequence; same for both SEQRES and ATOM records:

>d1ywgq1 c.2.1.3 (Q:1-152,Q:319-337) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcev
thadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvi
msappkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhitnn

Timeline for d1ywgq1:

• d1ywgq1 first appeared in SCOP 1.73
  
• d1ywgq1 appears in SCOPe 2.07