![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (4 PDB entries) Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337 |
![]() | Domain d1ywgo1: 1ywg O:1-152,O:319-337 [124145] Other proteins in same PDB: d1ywgo2, d1ywgp2, d1ywgq2, d1ywgr2 complexed with nad |
PDB Entry: 1ywg (more details), 2.6 Å
SCOPe Domain Sequences for d1ywgo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywgo1 c.2.1.3 (O:1-152,O:319-337) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} mavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcev thadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvi msappkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhitnn
Timeline for d1ywgo1: