Lineage for d1ywfa1 (1ywf A:4-275)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116644Family c.45.1.5: Mycobacterial PtpB-like [142348] (1 protein)
  6. 2116645Protein Phosphotyrosine protein phosphatase PtpB [142349] (1 species)
  7. 2116646Species Mycobacterium tuberculosis [TaxId:1773] [142350] (2 PDB entries)
    Uniprot P96830 4-275
  8. 2116647Domain d1ywfa1: 1ywf A:4-275 [124144]
    complexed with po4

Details for d1ywfa1

PDB Entry: 1ywf (more details), 1.71 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Protein Tyrosine Phosphatase PtpB
PDB Compounds: (A:) phosphotyrosine protein phosphatase ptpb

SCOPe Domain Sequences for d1ywfa1:

Sequence, based on SEQRES records: (download)

>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]}
relpgawnfrdvadtatalrpgrlfrsselsrlddagratlrrlgitdvadlrssrevar
rgpgrvpdgidvhllpfpdladddaddsaphetafkrlltndgsngesgessqsindaat
rymtdeyrqfptrngaqralhrvvtllaagrpvlthcfagkdrtgfvvalvleavgldrd
vivadylrsndsvpqlrarisemiqqrfdtelapevvtftkarlsdgvlgvraeylaaar
qtidetygslggylrdagisqatvnrmrgvll

Sequence, based on observed residues (ATOM records): (download)

>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]}
relpgawnfrdvadtatalrpgrlfrsselsrlddagratlrrlgitdvadlrssrevar
rgpgrvpdgidvhllpfpdladsindaatrymtdeyrqfptrngaqralhrvvtllaagr
pvlthcfagkdrtgfvvalvleavgldrdvivadylrsndsvpqlrarisemiqqrfdte
lapevvtftkarlsdgvlgvraeylaaarqtidetygslggylrdagisqatvnrmrgvl
l

SCOPe Domain Coordinates for d1ywfa1:

Click to download the PDB-style file with coordinates for d1ywfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ywfa1: