Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Nitrophorin 4 [50845] (1 species) |
Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries) Uniprot Q94734 22-205 |
Domain d1ywda_: 1ywd A: [124143] automated match to d1d2ua_ complexed with hem |
PDB Entry: 1ywd (more details), 1.08 Å
SCOPe Domain Sequences for d1ywda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywda_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks lltk
Timeline for d1ywda_: