Lineage for d1ywba_ (1ywb A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804617Protein Nitrophorin 4 [50845] (1 species)
  7. 2804618Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
    Uniprot Q94734 22-205
  8. 2804622Domain d1ywba_: 1ywb A: [124141]
    automated match to d1d2ua_
    complexed with hem, no, po4

Details for d1ywba_

PDB Entry: 1ywb (more details), 0.97 Å

PDB Description: 0.9 A Structure of NP4 from Rhodnius Prolixus complexed with NO at pH 5.6
PDB Compounds: (A:) Nitrophorin 4

SCOPe Domain Sequences for d1ywba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywba_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d1ywba_:

Click to download the PDB-style file with coordinates for d1ywba_.
(The format of our PDB-style files is described here.)

Timeline for d1ywba_: