SCOP 1.75: Domain d1ywaa1: 1ywa A:1-184

Lineage for d1ywaa1 (1ywa A:1-184)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 4 [50845] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50846] (34 PDB entries)
   Uniprot Q94734 22-205

8. Domain d1ywaa1: 1ywa A:1-184 [124140]
   automatically matched to d1d2ua_
   complexed with cmo, hem, po4

Details for d1ywaa1

PDB Entry: 1ywa, 0.89 Å

PDB Description: 0.9 A Structure of NP4 from Rhodnius Prolixus complexed with CO at pH 5.6

PDB Compounds: (A:) Nitrophorin 4

SCOP Domain Sequences for d1ywaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ywaa1 b.60.1.1 (A:1-184) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d1ywaa1:

• d1ywaa1 first appeared in SCOP 1.73
  
• d1ywaa1 is called d1ywaa_ in SCOPe 2.01
  
• d1ywaa1 appears in the current release, SCOPe 2.08, called d1ywaa_