Lineage for d1yw9a2 (1yw9 A:110-374,A:449-478)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732939Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 732940Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 732941Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 732993Protein Methionine aminopeptidase [55924] (5 species)
  7. 733038Species Human (Homo sapiens) [TaxId:9606] [55927] (16 PDB entries)
    methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
  8. 733043Domain d1yw9a2: 1yw9 A:110-374,A:449-478 [124139]
    Other proteins in same PDB: d1yw9a1
    automatically matched to d1b59a2
    complexed with a84, mn

Details for d1yw9a2

PDB Entry: 1yw9 (more details), 1.64 Å

PDB Description: h-MetAP2 complexed with A849519
PDB Compounds: (A:) Methionine aminopeptidase 2

SCOP Domain Sequences for d1yw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yw9a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOP Domain Coordinates for d1yw9a2:

Click to download the PDB-style file with coordinates for d1yw9a2.
(The format of our PDB-style files is described here.)

Timeline for d1yw9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yw9a1