SCOPe 2.01: Domain d1yw8a2: 1yw8 A:110-374,A:449-478

Lineage for d1yw8a2 (1yw8 A:110-374,A:449-478)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries)
   Uniprot P50579 110-478
   methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold

8. Domain d1yw8a2: 1yw8 A:110-374,A:449-478 [124137]
   Other proteins in same PDB: d1yw8a1
   automatically matched to d1b59a2
   complexed with a75, mn

Details for d1yw8a2

PDB Entry: 1yw8, 2.65 Å

PDB Description: h-MetAP2 complexed with A751277

PDB Compounds: (A:) Methionine aminopeptidase 2

SCOPe Domain Sequences for d1yw8a2:

Sequence; same for both SEQRES and ATOM records:

>d1yw8a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Timeline for d1yw8a2:

• d1yw8a2 first appeared in SCOP 1.73
  
• d1yw8a2 appears in SCOP 1.75
  
• d1yw8a2 appears in SCOPe 2.02
  
• d1yw8a2 appears in the current release, SCOPe 2.08