![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein Methionine aminopeptidase [55924] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries) Uniprot P50579 110-478 methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold |
![]() | Domain d1yw7a2: 1yw7 A:110-374,A:449-478 [124135] Other proteins in same PDB: d1yw7a1 automated match to d1r58a2 complexed with a41, mn |
PDB Entry: 1yw7 (more details), 1.85 Å
SCOPe Domain Sequences for d1yw7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yw7a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy
Timeline for d1yw7a2: