Lineage for d1yw6b_ (1yw6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2127107Family c.56.5.7: AstE/AspA-like [142526] (3 protein domains)
    Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)
  6. 2127123Protein Succinylglutamate desuccinylase AstE [142527] (4 species)
  7. 2127127Species Escherichia coli [TaxId:562] [142530] (1 PDB entry)
    Uniprot P76215 1-322
  8. 2127129Domain d1yw6b_: 1yw6 B: [124133]
    Other proteins in same PDB: d1yw6a2
    automated match to d1yw6a1
    complexed with so4

Details for d1yw6b_

PDB Entry: 1yw6 (more details), 3.1 Å

PDB Description: Crystal Structure of Succinylglutamate Desuccinylase from Escherichia coli, Northeast Structural Genomics Target ET72.
PDB Compounds: (B:) Succinylglutamate desuccinylase

SCOPe Domain Sequences for d1yw6b_:

Sequence, based on SEQRES records: (download)

>d1yw6b_ c.56.5.7 (B:) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]}
mdnflaltltgkkpvitereingvrwrwlgdgvleltpltppqgalvisagihgnetapv
emldallgaishgeiplrwrllvilgnppalkqgkrychsdmnrmfggrwqlfaesgetc
rareleqcledfydqgkesvrwhldlhtairgslhpqfgvlpqrdipwdekfltwlgaag
lealvfhqepggtfthfsarhfgalactlelgkalpfgqndlrqfavtasaiaallsges
vgivrtpplryrvvsqitrhspsfemhmasdtlnfmpfekgtllaqdgeerftvthdvey
vlfpnplvalglraglmlekis

Sequence, based on observed residues (ATOM records): (download)

>d1yw6b_ c.56.5.7 (B:) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]}
mdnflaltltgkkpvitereingvrwrwlgdgvleltpltppqgalvisagihgnetapv
emldallgaishgeiplrwrllvilgnppalkqgkrychsdmnrmfggrwqlfaesgetc
rareleqcledfydqgkesvrwhldlhtairgslhpqfgvlpqpwdekfltwlgaaglea
lvfhpggtfthfsarhfgalactlellrqfavtasaiaallsgivrtpplryrvvsqitr
hspsfemhmasdtlnfmpfekgtllaqdgeerftvthdveyvlfpnplvalglraglmle
kis

SCOPe Domain Coordinates for d1yw6b_:

Click to download the PDB-style file with coordinates for d1yw6b_.
(The format of our PDB-style files is described here.)

Timeline for d1yw6b_: